hmm

HHsearch 1.5
NAME cluster_0
FAM
FILE cluster_0
COM hhmake -i ./uals_mode_1471-2229-9-99-s3_0/aligned/cluster_0_aligned.fasta -name cluster_0 -o ./uals_mode_1471-2229-9-99-s3_0/hhms/cluster_0.hhm
DATE Sun Jun 26 15:44:16 2016
LENG 1107 match states, 1107 columns in multiple alignment
FILT 4 out of 6 sequences passed filter (-id 90 -cov 0 -qid 0 -qsc -20.00 -diff 100)
NEFF 1.2
SEQ

Consensus
mntggrliagshnrnefvlinadexarirsvxelsgqtcqicxdeieltvxgepfvacnecafpvcrpcyeyerregnqacpqcktrykrxkgsprvegd
deeeddiddlexefxygnlxgxxpexvxeaxlyxsrxntgrxshsntygxxxxxxldsappgsxiplltyxdedxxxxsdrhalivppslxgxgnrvhpx
xfxdxxxxxxxxrpmvpqkdxavygygsvawkdrmexwkxxqxeklqvvkhegxxdgxgxxfxxdelddpdxpmmdegrqplsrklpixssxinpyrmli
xxrlxilglffhyrilhpvndayglwltsviceiwfavswildqfpkwypieretyldrlslryekegkpsxlapvdvfvstvdplkepplitantvlsi
lavdypvdkvacyvsddgaamltfealsxtaefarkwvpfckkfxieprapewyfsqkmdylknkvhpafvrerramkrdyeefkvkinalvxtaqkvpe
dgwtmqdgtpwpgnnvrdhpgmiqvflgxsgvrdxxgnelprlvyvsrekrpgfdhhkkagamnslirvsavlsnapyllnvdcdhyinnskaxreamcf
mmdpqsgkkicyvqfpqrfdgidrhdrysnrnvvffdinmkgldgxqgpiyvgtgcvfrrqalygfdapkkkkppgktcncwpkwcxlccgxrkxxkxkx
kxxxkkxkxxexskqihalenieegxxxxxsnxxexxsexxqxklekkfgqspvfvasxxlxnggvprnaspaxllreaiqviscgyedktewgkeigwi
ygsvtediltgfkmhchgwrsvycxpkraafkgsapinlsdrlhqvlrwalgsveiflsrhcpiwygyggglkwlerfsyinsvvypwtslplxvycslp
aiclltgkfivpeisnyaxilfxxxfxsiaxtgilemqwgxvgiddwwrneqfwviggvsshlfalfqgllkvlagvxtnftvtskaaddgefselyifk
wtsllippttlliiniigvivgvsdaixngydswgplfgrlffalwvixhlypflkgllgkqdrmptiixvwsillasiltllwvrvnpfvxkxgpvlei
cglxcxx
AT2G21770.1|AT2G21770.1|cesA
MNTGGRLIAGSHNRNEFVLINADDTARIRSAEELSGQTCKICRDEIELTDNGEPFIACNECAFPTCRPCYEYERREGNQACPQCGTRYKRIKGSPRVEG-
DEEDDDIDDLEHEF-Y----GMDPEHVTEAALYYMRLNTGR-------GTDEVSHLYSASPGSEVPLLTYCDEDSDMYSDRHALIVPPS-TGLGNRVHHV
PFTDSFAS-IHTRPMVPQKDLTVYGYGSVAWKDRMEVWKKQQIEKLQVVKNERVNDGDGDGFIVDELDDPGLPMMDEGRQPLSRKLPIRSSRINPYRMLI
FCRLAILGLFFHYRILHPVNDAFGLWLTSVICEIWFAVSWILDQFPKWYPIERETYLDRLSLRYEKEGKPSELAPVDVFVSTVDPLKEPPLITANTVLSI
LAVDYPVEKVACYVSDDGAAMLTFEALSYTAEFARKWVPFCKKFSIEPRAPEWYFSQKMDYLKHKVDPAFVMERRAMKRDYEEFKVKINALVSVSQKVPE
DGWTMQDGTPWPGNNVRDHPGMIQVFLGHSGVCDMDGNELPRLVYVSREKRPGFDHHKKAGAMNSLIRVSAVLSNAPYLLNVDCDHYINNSKAIREAMCF
MMDPQSGKKICYVQFPQRFDGIDRHDRYSNRNVVFFDINMKGLDGIQGPIYVGTGCVFRRQALYGFDAPKKKQPPGRTCNCWPKWCCLCCGMRKKKTGKV
KDN-QRKKPKETSKQIHALEHIEEG--LQVTN-AENNSETAQLKLEKKFGQSPVLVASTLLLNGGVPSNVNPASLLRESIQVISCGYEEKTEWGKEIGWI
YGSVTEDILTGFKMHCHGWRSVYCMPKRAAFKGSAPINLSDRLHQVLRWALGSVEIFLSRHCPIWYGYGGGLKWLERFSYINSVVYPWTSLPLLVYCSLP
AICLLTGKFIVPEISNYAGILFLLMFMSIAVTGILEMQWGKIGIDDWWRNEQFWVIGGVSSHLFALFQGLLKVLAGVSTNFTVTSKAADDGEFSELYIFK
WTSLLIPPTTLLIINIVGVIVGVSDAINNGYDSWGPLFGRLFFALWVIVHLYPFLKGLLGKQDRVPTIILVWSILLASILTLLWVRVNPFVSKDGPVLEI
CGLDCLK
AT4G39350.1|AT4G39350.1|cesA
MNTGGRLIAGSHNRNEFVLINADESARIRSVQELSGQTCQICGDEIELTVSSELFVACNECAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVDGD
DEEEEDIDDLEYEFDH----GMDPEHAAEAAL-SSRLNTGR------------GGLDSAPPGSQIPLLTYCDEDADMYSDRHALIVPPS-TGYGNRVYPA
PFTDSSAP-PQARSMVPQKDIAEYGYGSVAWKDRMEVWKRRQGEKLQVIKHEGGNNGRGSN-DDDELDDPDMPMMDEGRQPLSRKLPIRSSRINPYRMLI
LCRLAILGLFFHYRILHPVNDAYGLWLTSVICEIWFAVSWILDQFPKWYPIERETYLDRLSLRYEKEGKPSGLAPVDVFVSTVDPLKEPPLITANTVLSI
LAVDYPVDKVACYVSDDGAAMLTFEALSDTAEFARKWVPFCKKFNIEPRAPEWYFSQKMDYLKNKVHPAFVRERRAMKRDYEEFKVKINALVATAQKVPE
EGWTMQDGTPWPGNNVRDHPGMIQVFLGHSGVRDTDGNELPRLVYVSREKRPGFDHHKKAGAMNSLIRVSAVLSNAPYLLNVDCDHYINNSKAIRESMCF
MMDPQSGKKVCYVQFPQRFDGIDRHDRYSNRNVVFFDINMKGLDGIQGPIYVGTGCVFRRQALYGFDAPKKKKPPGKTCNCWPKWCCLCCGLRKKSKTKA
KD--KKTNTKETSKQIHALENVDEGVIVPVSN-VEKRSEATQLKLEKKFGQSPVFVASAVLQNGGVPRNASPACLLREAIQVISCGYEDKTEWGKEIGWI
YGSVTEDILTGFKMHCHGWRSVYCMPKRAAFKGSAPINLSDRLHQVLRWALGSVEIFLSRHCPIWYGYGGGLKWLERFSYINSVVYPWTSLPLIVYCSLP
AVCLLTGKFIVPEISNYAGILFMLMFISIAVTGILEMQWGGVGIDDWWRNEQFWVIGGASSHLFALFQGLLKVLAGVNTNFTVTSKAADDGAFSELYIFK
WTTLLIPPTTLLIINIIGVIVGVSDAISNGYDSWGPLFGRLFFALWVIVHLYPFLKGMLGKQDKMPTIIVVWSILLASILTLLWVRVNPFVAKGGPVLEI
CGLNCGN
AT5G64740.1|AT5G64740.1|cesA
MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVDGEPFVACNECAFPVCRPCYEYERREGNQACPQCKTRFKRLKGSPRVEG-
DEEEDDIDDLDNEFEYGN-NGIGFDQVSEGMS-ISRRNSGFP----------QSDLDSAPPGSQIPLLTYGDEDVEISSDRHALIVPPSLGGHGNRVHPV
SLSDPTVA-AHPRPMVPQKDLAVYGYGSVAWKDRMEEWKRKQNEKLQVVRHEGDPD-------FEDGDDADFPMMDEGRQPLSRKIPIKSSKINPYRMLI
VLRLVILGLFFHYRILHPVKDAYALWLISVICEIWFAVSWVLDQFPKWYPIERETYLDRLSLRYEKEGKPSGLSPVDVFVSTVDPLKEPPLITANTVLSI
LAVDYPVDKVACYVSDDGAAMLTFEALSETAEFARKWVPFCKKYCIEPRAPEWYFCHKMDYLKNKVHPAFVRERRAMKRDYEEFKVKINALVATAQKVPE
DGWTMQDGTPWPGNSVRDHPGMIQVFLGSDGVRDVENNELPRLVYVSREKRPGFDHHKKAGAMNSLIRVSGVLSNAPYLLNVDCDHYINNSKALREAMCF
MMDPQSGKKICYVQFPQRFDGIDRHDRYSNRNVVFFDINMKGLDGLQGPIYVGTGCVFRRQALYGFDAPKKKKGPRKTCNCWPKWCLLCFGSRKNRKAKT
VAADKKKKNREASKQIHALENIEEGRVTKGSN-VEQSTEAMQMKLEKKFGQSPVFVASARMENGGMARNASPACLLKEAIQVISCGYEDKTEWGKEIGWI
YGSVTEDILTGFKMHSHGWRSVYCTPKLAAFKGSAPINLSDRLHQVLRWALGSVEIFLSRHCPIWYGYGGGLKWLERLSYINSVVYPWTSLPLIVYCSLP
AICLLTGKFIVPEISNYASILFMALFSSIAITGILEMQWGKVGIDDWWRNEQFWVIGGVSAHLFALFQGLLKVLAGVDTNFTVTSKAADDGEFSDLYLFK
WTSLLIPPMTLLIINVIGVIVGVSDAISNGYDSWGPLFGRLFFALWVIIHLYPFLKGLLGKQDRMPTIIVVWSILLASILTLLWVRVNPFVAKGGPILEI

NULL 3706 5728 4211 4064 4839 3729 4763 4308 4069 3323 5509 4640 4464 4937 4285 4423 3815 3783 6325 4665
HMM A C D E F G H I K L M N P Q R S T V W Y
M->M M->I M->D I->M I->I D->M D->D Neff Neff_I Neff_D
0 * * 0 * 0 * * * *
M 1 * * * * * * * * * * 0 * * * * * * * * * 1
0 * * * * * * 1188 0 0

N 2 * * * * * * * * * * * 0 * * * * * * * * 2
0 * * * * * * 1188 0 0

T 3 * * * * * * * * * * * * * * * * 0 * * * 3
0 * * * * * * 1188 0 0

G 4 * * * * * 0 * * * * * * * * * * * * * * 4
0 * * * * * * 1188 0 0

你可能感兴趣的